PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100183750221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 274aa    MW: 31103.1 Da    PI: 7.4568
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100183750221genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-3353107155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   kprl+Wt eLH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Ote100183750221|100183750221  53 KPRLKWTAELHQRFVDAVKQLGGPHKATPKSLMRIMGIQGLTLYHLKSHLQKYRL 107
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3350110IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3051108IPR009057Homeodomain-like
SuperFamilySSF466896.81E-1652108IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-2353108IPR006447Myb domain, plants
PfamPF002491.0E-855106IPR001005SANT/Myb domain
PfamPF143798.6E-15139176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
SQHNQPHLCF QIWSENIRHA NNYKENYHLP HTHTNINIMP HQQTNLLLSS DAKPRLKWTA  60
ELHQRFVDAV KQLGGPHKAT PKSLMRIMGI QGLTLYHLKS HLQKYRLGRS HHVKQQGENS  120
GSNSNCNAEE AQINDVQALE MQRKLEQQIE VQRHLQLRIE AQGRYLQSVL KKAQETLSRY  180
SACAVEVADS GCTTSSLTES EGSMLKEKLL GCSMEISLTF SHKNNQSDDD DGRSAEEWSA  240
KKNIDLNELD SGPTGIDLXX XXXXXXXXXF GSTF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075513.11e-69PREDICTED: myb family transcription factor APL-like
TrEMBLA0A022Q7C22e-65A0A022Q7C2_ERYGU; Uncharacterized protein
STRINGVIT_01s0026g02550.t011e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932